PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004508651.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family Dof
Protein Properties Length: 307aa    MW: 33361.4 Da    PI: 7.2508
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004508651.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-393392362
          zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                    ++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk+k+s+
  XP_004508651.1 33 HQALKCPRCDSINTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKSKRSN 92
                    6899****************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.9E-333490IPR003851Zinc finger, Dof-type
ProDomPD0074788.0E-253585IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.7023690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MQEIHSIGGG TKFFAAGTAD RRLRPHNNNH HNHQALKCPR CDSINTKFCY YNNYNLSQPR  60
HFCKNCRRYW TKGGVLRNVP VGGGCRKSKR SNKPKNSSSS SETTALPGTP PETENKSNSH  120
SSSESSSLTA AAVTEAVSTP SATNTNSKKT QESKLLSHVN QSNTDLGNDS LEQGTGDCGI  180
FSEIANFTSL ITSSNEALPF EFGNGNGNDF QWQHQKVMTV TGNQPNHNED VLKLLPGNMG  240
AGASLMDGVD FSALQNKTSN GGFGPLDWHG DGGADHGLFD LPNTVDQGYW AHTHWSDQDH  300
SNLFHLP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004508651.10.0PREDICTED: dof zinc finger protein DOF5.4
TrEMBLA0A072UQU91e-113A0A072UQU9_MEDTR; Dof domain zinc finger protein
STRINGGLYMA17G08950.12e-88(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.15e-33OBF binding protein 4